PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00003591.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 335aa    MW: 37297.2 Da    PI: 4.844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00003591.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49e-153178148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    +g W++eEde+l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  FANhyb_rscf00003591.1.g00001.1 31 KGLWSPEEDEKLMRYMLNNGQGCWSDVARNAGLERCGKSCRLRWINYL 78
                                    678*******************************************97 PP

2Myb_DNA-binding48.91.5e-1584127146
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     rg+++t+E++l+++ + +lG++ W+ Ia++++ gRt++++k++w++
  FANhyb_rscf00003591.1.g00001.1  84 RGAFSTQEEDLIIHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 127
                                     89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-232581IPR009057Homeodomain-like
PROSITE profilePS5129416.9342678IPR017930Myb domain
SuperFamilySSF466892.7E-2729125IPR009057Homeodomain-like
SMARTSM007179.0E-113080IPR001005SANT/Myb domain
PfamPF002492.1E-133178IPR001005SANT/Myb domain
CDDcd001677.38E-93478No hitNo description
PROSITE profilePS5129423.98579133IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2482133IPR009057Homeodomain-like
SMARTSM007171.7E-1483131IPR001005SANT/Myb domain
PfamPF002493.2E-1484127IPR001005SANT/Myb domain
CDDcd001674.78E-1086126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MRKPEPYAAS STGGKNNKNN SGMSSNNKLR KGLWSPEEDE KLMRYMLNNG QGCWSDVARN  60
AGLERCGKSC RLRWINYLRP DLKRGAFSTQ EEDLIIHFHS LLGNRWSQIA ARLPGRTDNE  120
IKNFWNSTIK KRLKILSSSS STASPNASDS SSEQPNNNDF FAAAGGGGGF MNIIPPSMMP  180
IYPDSSMQAT SLINHMFDPF PMVEHGGYYN NGNPCTAQIG SVGSGSSTGD DCGFGQNIDV  240
FGNVNMRVEE DIYVPPLESV STIDQDQNNL KTETIFYDHN NYYSNTNNII KGENMIGVGN  300
YFEDDHHDQG LTMGEWDLED LMKDVSSFPL LDYQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27291335108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291790.10.0PREDICTED: transcription factor MYB46
TrEMBLF2QKX10.0F2QKX1_R
STRINGGLYMA11G14200.21e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-69myb domain protein 83